Protein Labeling Reagents
CPC Scientific 5FAM-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: 5FAM-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C164H256N50O48S4MOLECULAR WEIGHT:3824.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
![eMolecules Broadpharm / FAM maleimide 6-isomer / 25mg / 761705717 / BP-28922 / / / [null] / 498.447 / C27H18N2O8](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502472432.JPG-250.jpg)
eMolecules Broadpharm / FAM maleimide 6-isomer / 25mg / 761705717 / BP-28922 / / / [null] / 498.447 / C27H18N2O8
Broadpharm / FAM maleimide 6-isomer / 25mg / 761705717 / BP-28922 / / / [null] / 498.447 / C27H18N2O8
![eMolecules Broadpharm / BP fluor 568 azide 6-isomer / 1mg / 761705616 / BP-28894 / / / [null] / 853.020 / C36H34K2N6O10S2](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502458768.PNG-250.jpg)
eMolecules Broadpharm / BP fluor 568 azide 6-isomer / 1mg / 761705616 / BP-28894 / / / [null] / 853.020 / C36H34K2N6O10S2
Broadpharm / BP fluor 568 azide 6-isomer / 1mg / 761705616 / BP-28894 / / / [null] / 853.020 / C36H34K2N6O10S2
eMolecules Broadpharm / Cy7 diacid / 1mg / 349512526 / BP-23600 / / / MFCD30723208 / 685.350 / C42H53ClN2O4
Broadpharm / Cy7 diacid / 1mg / 349512526 / BP-23600 / / / MFCD30723208 / 685.350 / C42H53ClN2O4
eMolecules BP Fluor 568 DBCO | | | 25mg
Broadpharm | BP Fluor 568 DBCO | 25mg | 599128687 | BP-25573 | | | | 953.050 | C51H44N4O11S2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
![eMolecules Broadpharm / IR 650 NHS ester / 1mg / 713699984 / BP-28159 / / / [null] / 1032.180 / C46H53N3O16S4](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502454140.PNG-250.jpg)
eMolecules Broadpharm / IR 650 NHS ester / 1mg / 713699984 / BP-28159 / / / [null] / 1032.180 / C46H53N3O16S4
Broadpharm / IR 650 NHS ester / 1mg / 713699984 / BP-28159 / / / [null] / 1032.180 / C46H53N3O16S4
Apexbio Technology LLC Sulfo-NHS-SS-11-Biotin,100mg
Sulfo-NHS-SS-11-biotin is a long-chain cleavable amine-reactive biotinylation reagent. The presence of the negatively charged sulfonate group in the chemical structure of sulfo-NHS-SS-11-biotin makes it a water-soluble biotinylation reagent that can be directly added to aqueous reactions without prior dissolution of organic solvents. Although no prior dissolution is required, an aqueous stock solution of sulfo-NHS-SS-11-biotin must be prepared rapidly and used immediately in case of the occurrence of hydrolysis of the active ester. Sulfo-NHS-SS-11-biotin has been used to react with amine-containing proteins and other molecules forming a complex which further interacts with avidin or streptavidin probes and to purify targeted molecules using affinity chromatography on a column of immobilized avidin or streptavidin. Other sizes are also available. Please inqury us for quote.
Selleck Chemical LLC Maleimide S3141-100mg
Maleimide exhibits fluorescence quenching ability and can be used for the specific detection of thiol analytes as fluorogenic probes Maleimide is also used for production of antibody-drug conjugate (ADC) which is used in cancer research
![eMolecules Broadpharm / Cy7 NHS ester / 1mg / 296213718 / BP-22538 / 95.000 / 1432019-64-1 / [null] / 733.660 / C41H48BF4N3O4](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502455003.PNG-250.jpg)
eMolecules Broadpharm / Cy7 NHS ester / 1mg / 296213718 / BP-22538 / 95.000 / 1432019-64-1 / [null] / 733.660 / C41H48BF4N3O4
Broadpharm / Cy7 NHS ester / 1mg / 296213718 / BP-22538 / 95.000 / 1432019-64-1 / [null] / 733.660 / C41H48BF4N3O4
eMolecules BP Fluor 568 Alkyne | | | 25mg
Broadpharm | BP Fluor 568 Alkyne | 25mg | 599128684 | BP-25572 | | | | 731.790 | C36H33N3O10S2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
NCCCCCC[NH3+])c3ccc(cc3C2(C)C)S([O-])(=O)=O)C(C)(C)c2cc(ccc12)S([O-])(=O)=O | 50mg | 462125622](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502183456.JPG-250.jpg)
eMolecules 2183440-44-8 | Sulfo-Cy5 amine | Broadpharm740.980 | C38H52N4O7S2 | 95.000 | CN1\C(=C\C=C\C=C\C2=[N+](CCCCCC(=O)NCCCCCC[NH3+])c3ccc(cc3C2(C)C)S([O-])(=O)=O)C(C)(C)c2cc(ccc12)S([O-])(=O)=O | 50mg | 462125622
Sulfo-Cy5 amine | Broadpharm | 2183440-44-8740.980 | C38H52N4O7S2 | 95.000 | CN1\C(=C\C=C\C=C\C2=[N+](CCCCCC(=O)NCCCCCC[NH3+])c3ccc(cc3C2(C)C)S([O-])(=O)=O)C(C)(C)c2cc(ccc12)S([O-])(=O)=O | 50mg | 462125622
eMolecules BP Fluor 546 Azide | | | 25mg
Broadpharm | BP Fluor 546 Azide | 25mg | 599128640 | BP-25559 | | | | 972.360 | C40H45Cl3N6O10S3
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
eMolecules 219729-26-7 | 5-Carboxyrhodamine 110 NHS Ester | Broadpharm471.425 | C25H17N3O7 | 95.000 | Nc1ccc2c(-c3ccc(cc3C(O)=O)C(=O)ON3C(=O)CCC3=O)c3ccc(=N)cc3oc2c1 | 100mg | 599128781
5-Carboxyrhodamine 110 NHS Ester | Broadpharm | 219729-26-7471.425 | C25H17N3O7 | 95.000 | Nc1ccc2c(-c3ccc(cc3C(O)=O)C(=O)ON3C(=O)CCC3=O)c3ccc(=N)cc3oc2c1 | 100mg | 599128781
